Teduglutide API Manufacturer in India

Swapnroop Pharma · WHO-GMP Certified · +91 87670 62101

Teduglutide API Manufacturer in India

Teduglutide is a 33-amino-acid recombinant peptide and glucagon-like peptide-2 (GLP-2) analogue used for the treatment of Short Bowel Syndrome (SBS) in patients dependent on parenteral support. It is manufactured using recombinant DNA technology in a modified strain of Escherichia coli. Teduglutide differs from naturally occurring human GLP-2 by substitution of alanine with glycine, which contributes to increased resistance to degradation by dipeptidyl peptidase-4.

Teduglutide API Overview

Teduglutide is a peptide therapeutic containing 33 amino-acid residues. Its sequence is:

HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

The peptide has a molecular formula of C164H252N44O55S and a molecular weight of approximately 3752.1 Da. PubChem lists CAS 197922-42-2 for Teduglutide.

Teduglutide acts as a GLP-2 receptor agonist and is designed to enhance intestinal adaptation and reduce dependence on parenteral nutritional/fluid support in patients with Short Bowel Syndrome.

PubChem identifies Teduglutide as a 33-membered polypeptide and recombinant GLP-2 analogue. FDA labeling describes the drug substance as a clear, colorless to light-straw-colored liquid before formulation into the finished lyophilized product.

Pharmaceutical Applications

Teduglutide is primarily used for the treatment of Short Bowel Syndrome (SBS) in adults and pediatric patients aged 1 year and older who are dependent on parenteral support.

As a GLP-2 receptor agonist, teduglutide promotes intestinal growth and improves intestinal absorptive capacity. This can help reduce the need for parenteral nutrition and intravenous fluid support in appropriately treated SBS patients.

Quality and Analytical Testing

Because Teduglutide is a peptide API, quality control requires peptide-specific analytical characterization rather than relying solely on conventional small-molecule tests.

The current EMA assessment identifies active-substance testing for:

  • Description
  • Appearance of solution
  • Solubility
  • pH
  • HPLC identification
  • Monoisotopic mass
  • Amino-acid analysis
  • HPLC assay
  • Related substances
  • Trifluoroacetic acid content
  • Acetic acid content
  • N,N-Dimethylformamide
  • Residual solvents
  • Triethylamine
  • Sodium content
  • Water by Karl Fischer
  • Microbial purity
  • Bacterial endotoxins
  • Oligomer content 

Additional peptide characterization can include peptide mapping, sequence confirmation, oxidation/deamidation monitoring, aggregate/oligomer assessment and bioassay/relative potency.

Teduglutide API Manufacturer in India

Swapnroop supports pharmaceutical API requirements with quality-focused analytical testing, technical documentation and supply support for pharmaceutical development and manufacturing.

Teduglutide API can be supported with appropriate specifications, analytical documentation and batch-specific CoA according to the intended pharmaceutical application.

Packaging and Storage

Teduglutide is a sensitive peptide and should be protected from inappropriate temperature, moisture and environmental exposure. The EMA assessment reports active-substance packaging in a low-density polyethylene (LDPE) bag compliant with applicable EU packaging requirements.

Storage conditions should always follow the approved specification and stability data for the particular Teduglutide API form and batch.

Documentation

Documentation may include:

  • Certificate of Analysis (CoA)
  • Product Specification
  • Safety Data Sheet (SDS/MSDS)
  • HPLC purity report
  • LC-MS/MALDI-MS identity report
  • Amino-acid analysis
  • Related-substances profile
  • Residual-solvent report
  • Water-content report
  • Endotoxin report
  • Microbial testing
  • Stability information
  • Regulatory documentation, where applicable

Why Choose Teduglutide API from Swapnroop?

Swapnroop focuses on quality-oriented pharmaceutical API solutions supported by analytical testing and technical documentation. Teduglutide can be supplied according to agreed specifications and customer requirements for pharmaceutical development and manufacturing.

Detailed Specifications

Parameter Specification
Appearance white to off-white crystalline powder
Identification IR & HPLC compliant
Assay (HPLC) 98.0% – 102.0%
Individual Impurity NMT 0.5%
Total Impurities NMT 1.0%
Water Content NMT 5.0%
Get Bulk Quote via WhatsApp