ACTH (Adrenocorticotropic Hormone) Manufacturer in India

Swapnroop Pharma · WHO-GMP Certified · +91 87670 62101

ACTH (Adrenocorticotropic Hormone) Manufacturer in India

ACTH – Adrenocorticotropic Hormone / Corticotropin

Swapnroop Pharma offers ACTH (Adrenocorticotropic Hormone), also known as Corticotropin, for pharmaceutical and research-related applications, subject to applicable product specifications and regulatory requirements.

Human ACTH is a peptide hormone consisting of 39 amino acids and is derived from the proopiomelanocortin (POMC) precursor. ACTH plays an important physiological role in stimulating the adrenal cortex and regulating adrenal corticosteroid production.

ACTH Product Identification

ACTH is also known as Adrenocorticotropic Hormone, Adrenocorticotropin, Adrenocorticotrophin and Corticotropin.

  • Product Name: ACTH (1-39)
  • Full Name: Adrenocorticotropic Hormone
  • Synonym: Corticotropin
  • CAS Number: 12279-41-3
  • Molecular Formula: C207H308N56O58S
  • Molecular Weight: Approximately 4541 g/mol
  • Product Type: Peptide Hormone
  • Category: Peptide / Hormonal Active Ingredient
  • Sequence Length: 39 amino acids

ACTH Applications

ACTH is used in pharmaceutical, diagnostic, biochemical and research applications according to applicable regulatory requirements.

Potential applications include:

  • Adrenal function testing
  • Endocrine and hormonal research
  • Pharmaceutical research
  • Biochemical research
  • Peptide research
  • Reference and analytical applications

Clinical use of ACTH preparations is subject to applicable medical, pharmaceutical and regulatory requirements.

Human ACTH (1-39)

Human ACTH (1-39) is a 39-amino-acid peptide. Its amino acid sequence is:

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

The peptide sequence and molecular information are documented by PubChem for human ACTH(1-39).

Product Quality

ACTH is a peptide product and should be evaluated using appropriate analytical methods suitable for peptide identity, purity and biological activity.

Product specifications may include:

  • Peptide identity
  • Purity
  • Assay
  • Related peptides
  • Water content
  • Residual solvents
  • Counter-ion or salt content, where applicable
  • Microbiological quality, where applicable
  • Endotoxin, where applicable
  • Biological activity, where applicable

Specifications should be confirmed against the applicable product specification, pharmacopoeial requirements and current Certificate of Analysis.

Packaging and Documentation

ACTH can be supplied in packaging appropriate for peptide stability and customer requirements.

Relevant technical documentation may be provided according to product and customer requirements, including Certificate of Analysis (CoA), Safety Data Sheet and applicable technical documentation, subject to availability.

Why Choose Swapnroop Pharma for ACTH?

  • ACTH / Corticotropin product availability
  • Peptide product handling
  • Quality-focused supply
  • Technical documentation support
  • Bulk and customized requirements
  • Support for pharmaceutical and research customers
  • Customer-specific documentation support

Request a Quote for ACTH

Looking for ACTH (Adrenocorticotropic Hormone) or Corticotropin?

Contact Swapnroop Pharma for product specifications, availability, documentation, packaging requirements and commercial quotations.

Get in touch with our team to discuss your ACTH requirement.

Detailed Specifications

Parameter Specification
Appearance White to off-white lyophilized powder
Identification Complies by suitable analytical method
Assay (HPLC) As per approved specification
Water Content As per approved specification
Get Bulk Quote via WhatsApp