Swapnroop Pharma offers ACTH (Adrenocorticotropic Hormone), also known as Corticotropin, for pharmaceutical and research-related applications, subject to applicable product specifications and regulatory requirements.
Human ACTH is a peptide hormone consisting of 39 amino acids and is derived from the proopiomelanocortin (POMC) precursor. ACTH plays an important physiological role in stimulating the adrenal cortex and regulating adrenal corticosteroid production.
ACTH is also known as Adrenocorticotropic Hormone, Adrenocorticotropin, Adrenocorticotrophin and Corticotropin.
ACTH is used in pharmaceutical, diagnostic, biochemical and research applications according to applicable regulatory requirements.
Potential applications include:
Clinical use of ACTH preparations is subject to applicable medical, pharmaceutical and regulatory requirements.
Human ACTH (1-39) is a 39-amino-acid peptide. Its amino acid sequence is:
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
The peptide sequence and molecular information are documented by PubChem for human ACTH(1-39).
ACTH is a peptide product and should be evaluated using appropriate analytical methods suitable for peptide identity, purity and biological activity.
Product specifications may include:
Specifications should be confirmed against the applicable product specification, pharmacopoeial requirements and current Certificate of Analysis.
ACTH can be supplied in packaging appropriate for peptide stability and customer requirements.
Relevant technical documentation may be provided according to product and customer requirements, including Certificate of Analysis (CoA), Safety Data Sheet and applicable technical documentation, subject to availability.
Looking for ACTH (Adrenocorticotropic Hormone) or Corticotropin?
Contact Swapnroop Pharma for product specifications, availability, documentation, packaging requirements and commercial quotations.
Get in touch with our team to discuss your ACTH requirement.
| Parameter | Specification |
|---|---|
| Appearance | White to off-white lyophilized powder |
| Identification | Complies by suitable analytical method |
| Assay (HPLC) | As per approved specification |
| Water Content | As per approved specification |